auto
Find a product
Back to results

LAMP3 (Human) Recombinant Protein Abnova #H00027074-H01

LAMP3 (Human) Recombinant Protein

  • Company: Abnova
  • Product code: H00027074-H01
  • Review rating:4.00 (1 review)

Product Details

1DB_ID: 1DB-001-0001200108
Company: Abnova
Company product code: H00027074-H01
Product name: LAMP3 (Human) Recombinant Protein
Product type: Protein
Size/Price: 25 ug/
Protein name: LAMP3
Tested applications: ELISA, WB, Electrophoresis
Species: Human
Description: Purified LAMP3 (AAH32940.1 28 a.a. - 381 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Concentration: > 10 ug/ml
Storage instructions: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Sequence: KAFPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT
Molecular Weight: 44.22 kDa
Purification: Strep-Tactin affinity columns
Form: Liquid
Preparation Details: Transfection of pSuper-LAMP3 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.

Reviews (1)

4 - Excellent (Publishable / Ideal reagent)
Application: WB
Sample: human ovarian lysate
Buffer: bsa
Dilution: 1/1000
See all reviews

1DegreeBio goes to great lengths to ensure the accuracy of the product information listed on the site, but we still encourage you to check with vendors to confirm product details before purchasing.

About Abnova

Abnova is the world's largest antibody manufacturer. They have the capacity of generating 500 mouse monoclonal antibodies and 500 rabbit polyclonal antibodies per month. Rather than the traditional method of antibody production, Abnova is taking a genomic/proteomic approach for antibody development. Abnova's goal is to have at least one antibody to every human expressed gene in the human genome. Abnova manufactures all its products, recombinant proteins and antibodies in its state-of-the-art production and SPF animal facilities. Abnova also has multiple clones for their monoclonal antibodies, and access is available to these clones for partners and collaborators from the academic institutions and industry.