auto
Find a product
Back to results

Rabbit anti-TP53 antibody Santa Cruz Biotechnology, Inc. #sc-6243

Rabbit anti-TP53 antibody

Product Details

1DB_ID: 1DB-001-0000429213
Company: Santa Cruz Biotechnology, Inc.
Company product code: sc-6243
Product name: p53 Antibody (FL-393)
Product type: Primary, Antibody
Size/Price: 200 µg/ml/
Target: TP53
clone: FL-393
Tested applications: ELISA, FACS, IF, IHC, IP, WB
Host: Rabbit
Reacts with: Human, Mouse, Rat
Description: MEEPQSDPSVEPPLSQETFSDLWKLLPENN p53 Antibody (FL-393) is a rabbit polyclonal IgG provided at 200 µg/ml; also available as goat IgG provided at 200 µg/ml, sc-6243-G epitope mapping within amino acids 1-393 representing full length p53 of human origin recommended for detection of p53 of mouse, rat and human origin by WB, IP, IF, IHC(P), FCM and ELISA agarose conjugate for IP studies, sc-6243 AC, 500 µg/0.25 ml agarose Alexa Fluor® 405 (sc-6243 AF405), Alexa Fluor® 488 (sc-6243 AF488) and Alexa Fluor® 647 (sc-6243 AF647) conjugates for FCM or immunofluorescence; 100 µg/2 ml HRP conjugate, sc-6243 HRP, 200 µg/ml TransCruz reagent for Gel Supershift and ChIP applications, sc-6243 X, 200 µg/0.1 ml fluorescein (sc-6243 fiTC) and phycoerythrin (sc-6243 PE) conjugates for FCM, 100 tests
Isotype: IgG

Reviews (4)

3 - Good (Publishable / Would use again)
Application: ICC
Sample: different cancer cell lines
Buffer: 1% BAS in PBS
Dilution: 1/100
4 - Excellent (Publishable / Ideal reagent)
Application: WB
Sample: T98G cells
Buffer: 5% nonfat milk in TBST
Dilution: 1/500
3 - Good (Publishable / Would use again)
Application: WB
Sample: Rat Liver Extract
Buffer: 5% Skim Milk
Dilution: 1:700
3 - Good (Publishable / Would use again)
Application: WB
Sample: Mouse Whole Spleen Lysate
Buffer: PBS
Dilution: 1/500
See all reviews

Verified publications (3)

PLoS ONE, 2011
Tpr is a large coiled-coil protein located in the nuclear basket of the nuclear pore complex for which many different functions were proposed from ...
Genes Dev., 2011
The p53 pathway is critical for tumor suppression, as the majority of human cancer has a faulty p53. Here, we identified RNPC1, a p53 target and a ...
J. Biol. Chem., 2011
p53 is frequently mutated in tumor cells, and mutant p53 is often highly expressed due to its increased half-life. Thus, targeting mutant p53 for ...
See all publications

1DegreeBio goes to great lengths to ensure the accuracy of the product information listed on the site, but we still encourage you to check with vendors to confirm product details before purchasing.

About Santa Cruz Biotechnology, Inc.

Santa Cruz Biotechnology, Inc. is focused on the ongoing development of research antibodies. It is their goal to continue to offer the broadest range of research reagents in the field. They provide superior, innovative primary antibodies and support products.