auto
Find a product
Back to results

Polyclonal Rabbit anti-HDAC7 antibody Atlas Antibodies #HPA004775

Polyclonal Rabbit anti-HDAC7 antibody

Product Details

1DB_ID: 1DB-001-0000587874
Company: Atlas Antibodies
Company product code: HPA004775
Product name: Anti-HDAC7
Product type: Primary, Antibody
Size/Price: 100µl/
Target: HDAC7
Tested applications: IF, IHC, WB
Host: Rabbit
Reacts with: Human, Mouse, Rat
Clonality: Polyclonal
Purity: Affinity purified
Isotype: IgG
Storage instructions: Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Specification Feature: This antibody has been used for staining of 48 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type.
Form deail: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Ensembl Gene ID: ENSG00000061273
NCBI Gene ID: 51564
Gene Synonyms: DKFZP586J0917, HDAC7A
Gene Description: histone deacetylase 7
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRK
Antigen Sequence Identity to Mouse: 91%
Antigen Sequence Identity to Rat: 90%

Quality control data

Immunohistochemistry

HPA004775
Click image to view full-size

Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.


Immunofluorescence microscopy

HPA004775
Click image to view full-size

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.


Western blot

HPA004775
Click image to view full-size

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil


Western blot

HPA004775
Click image to view full-size

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)





1DegreeBio goes to great lengths to ensure the accuracy of the product information listed on the site, but we still encourage you to check with vendors to confirm product details before purchasing.

About Atlas Antibodies

At Atlas Antibodies we have a very singular mission: To provide our customers with highly characterized antibodies targeting all human proteins. Working in close partnership with the Human Protein Atlas (HPA) project (www.proteinatlas.org), we are looking to complete the systematic exploration of the human proteome using antibodies. Of the possible 20,000 protein coding genes in the human body we already have over 15,000 antibodies covering 13,000 gene products. Each antibody is supported by over 700 in depth annotated immunohistochemical and immunofluorescence images. OUR ANTIBODIES To date we have over 15,000 primary antibodies in our catalog, covering 13,000 gene products. 99% of our antibodies are available in stock and ready for shipping, You can order directly from or online store, www.atlasantibodies.com/products. Our delivery times to US, Canada and Europe are 1-4 days. Fother destinations, information is available at atlasantibodies.com/distribution Antibody specificity by design: Antigen selection is performed using a propritary bioinformatics software. 50-150 amino acid regions with the lowest possible sequence identity to other human proteins are selected, cloned and recombinantly produced in a tightly controlled process. Standardized production method: Our experience in manufacturing antibodies provides us with a deep understanding about the difficulties associated with production of high performance antibodies. This has enabled us to develope a standardized production process, which ensures the highest quality of antibodies. Antigen affinity purification: All our polyclonal antibodies are affinity purified in an automated three-step purification process using the corresponding antigen as affinity-ligand in the main capture step. Manually annotated characterization data: Each antibody is supported by over 700 in depth manually annotated immunohistochemical and immunofluorescence images. More information about our antibodies is available at www.atlasantibodies.com